SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF10_0268 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF10_0268
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.85e-25
Family Glutathione peroxidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PF10_0268
Sequence length 393
Comment MCP1 merozoite capping protein 1 12219979:12221992 reverse MW:43930
Sequence
MAQLAENTVLDESIQKVEVLNHNGETTSFYNEVEKHKENNEGIVVFTYPKANTPGCTKQA
ELFKEKHEEFVNNKYVVYGLSADTAEDQLKWKEKLELPYELLCDVDKNLLKLLGLTNEED
KTIRSHLVLKNDFTVSYVKKSVSPGKSATQVLNFLVNGDDGGDGNEEEENEENNNNEDKD
NNENDEEGDVQGEGEGEGEGDEEKTADTDKEKPKKSSTSTQKKKGSVSSTISKKSVKKSN
KVVKKNVKVKKEIKKKTNKKADNKKGKNVNNKLMKSNAKGANKKGGKKNSVVKKEDNKKK
GKNNKKKNKNQNLKDLKKKNVKSGKGSVSSSNKKLPKGLKNAAKKAGKKIDKKKEQANKK
NNNNKNKNKNKNLSKGNNMKHNKKPAKKVVKKK
Download sequence
Identical sequences A0A024X7A6 A0A0L7M3G5 A0A2I0BR47 Q8IJD0 W4IFG2 W7FE43
gi|124802661|ref|XP_001347552.1| gi|23495134|gb|AAN35465.1| XP_001347552.1.26446 5833.PF10_0268-1 GO.78781 PF10_0268 PFDG_03465T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]