SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF11_0055 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF11_0055
Domain Number 1 Region: 64-248
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000318
Family Thioltransferase 0.049
Further Details:      
 
Domain Number 2 Region: 275-400
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000897
Family Thioltransferase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PF11_0055
Sequence length 424
Comment PF11_0055 conserved protein, unknown function 12963815:12965403 forward MW:49266
Sequence
MKTNIFSCVISFFILLLFCKAYNTSSLLETIKHDLQIVNNSNFNTVVNKFRNEKVFAVLF
FKKSNKNIKNVIKNYNDVASKFKGILTLCVVDCDENASLCENELSLYVPDYKSSNTHHFL
IYPINPMPKFVFKDEITESNIKKYTYLIPSKIDIIKDTQSFNVFLSKHENMPKVLIFSNK
KKPNYVLNALSNSFNKKLMFAYINNENEELVAKYNVKNLPTILLLKKNKVVDTYKGKQNY
INIFDWLNVYSETFVLGGGFDISPDKTNEKPWKFELIPKFTKLSHGDICFKKADKGLCLI
YLKEGEKLEKSEIDMLLSLKEKFKPHIDGRGINFRFMWIDIAMETHFRSLLEFKKYPSVV
VFNPYKRIRYAKLNEDLTATKENIEKLLEKISGGDAKFTMLKGQTLPEFIQDPNAAKANE
KDEL
Download sequence
Identical sequences A0A024V5S9 A0A024W694 A0A0L1I526 Q8IIV8 W4IF41 W7EZT2 W7K5F9
XP_001347731.1.26446 PF11_0055 gi|124803477|ref|XP_001347731.1| gi|23495981|gb|AAN35644.1| 5833.PF11_0055-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]