SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF11_0099 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF11_0099
Domain Number 1 Region: 32-122
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.97e-30
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 168-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-22
Family PDI-like 0.018
Further Details:      
 
Domain Number 3 Region: 430-518
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000175
Family Thioltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PF11_0099
Sequence length 540
Comment PF11_0099 heat shock protein DnaJ homologue Pfj2 13140285:13141907 reverse MW:62377
Sequence
MNVTNVVKRRKKLSYFHSLLLIIFSFFLSCARGMDYYKRLGVKRNATKEDISKAYRQLAK
EYHPDIAPDKEKDFIEIANAYETLSDPEKRKMYDMYGEDYAQGGMGGGSPGRGEHAHGFH
FDQDVVNEIFKQFAGGGGAGASGGRAGNFHFKFTSGGPSFNHFEDEYEDIYKNEVLKINS
KNIESVLNDISFSLIINFYSPTCSHCISFKKKYLKLRKKFDGYITFAVVNCQEENMLCRK
YNVKSLPQLILMRSDKTYETFYGNRTDENLTYFIKNNIPSAIIECNNQKKLDNFLTQNIE
IPKVLFFISHNDNIVMLKALSLEFKKRINIGIIYNTNYSVMKLFKKKNIKTPSLLLVDDI
DSLSGDLTQLKNFDFNILSLKLSHIVAQNRLKNNLYGHVTSYQELTKKKYESGQCHEKDS
QICFFILKLLKKNYKSFDEDIKKVANKFSSDPLKILYINIYQQPYILDSFGLSNNIQYSN
GLILVAFRPKRQKFKVYDGDVNVENVHKFVDNVVSGGIPINQNIKRSLKFVHVEQYDDEL
Download sequence
Identical sequences A0A024V4L6 A0A024W6C6 A0A024X637 Q8IIR6 W4IRV7 W7FH05 W7JBA2 W7K453
gi|124803627|ref|XP_001347774.1| gi|23496025|gb|AAN35687.1| 5833.PF11_0099-1 PF11_0099 XP_001347774.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]