SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF11_0253 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF11_0253
Domain Number 1 Region: 107-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-26
Family UAS domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PF11_0253
Sequence length 392
Comment PF11_0253 conserved Plasmodium protein, unknown function 13724560:13725888 reverse MW:46082
Sequence
MCNGNVEDSLKLYYDINGDNMIPNKPYDNNNKIMTEEEKSVQSNMYQTNTETTNDKKKNI
CPPCDDYVRAPDKHFSQALINDMDDSNFYPYNNTNKKSNKSKIQLGDTFQKLFSPPESLI
CSLSFEEVRKKSKQENKFILVNIQNTEFESLRLNRDIWNNDVIQQIIKTSFILWLRYEYD
QDAALFMNTYKVHKLPYLCVLCKRTGRQLKVWNIRNFQDPICAQSQLYEFIEMMEIKSNS
RNIKDITTSSKNISTNILDTTTTTTTTTTTTTNININNNNNYGDRDDHGDDHMLHNINNK
NIDTLKEPYRNIPPSGYDKNKLLYPETTHQILQEEKKDSIHNFNNNSYNNPNLKETESED
KKTPDVVEEYNTINNELSQLHKLRMQRFQKKN
Download sequence
Identical sequences A0A0L7KGX2 Q8IIC1
gi|124804174|ref|XP_001347924.1| gi|23496177|gb|AAN35837.1| XP_001347924.1.26446 PF11_0253 5833.PF11_0253-1 PFHG_04358T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]