SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF13_0214 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF13_0214
Domain Number 1 Region: 251-411
Classification Level Classification E-value
Superfamily eEF1-gamma domain 2.48e-56
Family eEF1-gamma domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 83-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.57e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000137
Family Glutathione S-transferase (GST), N-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PF13_0214
Sequence length 411
Comment PF13_0214 elongation factor 1-gamma, putative 18625749:18627453 forward MW:47777
Sequence
MDFKLLAPKNDVRTLKVQTVASFCNVKLNMPNFELGKDNKTADFLKHSPLGRLPVLVTSH
GSIFESNAVCKYLCSIHREGDYLGKGSFEEAQVNMWVDFNTYELEIPMTCYMNNKSCEKS
LKHIEDTLKCYNNHLLYNQYMVGNSITIADIFISVILYFSLNSGALNESIVLKYKNLYRL
YDTISNQKQFKYVFACDQNKKKNTQDKSTGAKKKQGNNKKDDNNNNNNNDADNQHADLLS
DDLAEKKQPKKTNPLDLLPPSNFSLDEWKYKFSNEKDLLNNAMPHFWKTYDPNGFSLYYM
KYDKLEDECQISFVACNMAGGFLQRLENNFSKYSFAVVTVLGENKSYDIEGVWLFRGTDI
PFEMKDHPSFEYHIFKKLDINNTQDKKIVEEYWCSKETVDNRPLVDRKVWK
Download sequence
Identical sequences A0A024V1U6 A0A0L7KCY8 A0A2I0BVK7 Q8IDV0 W4IA00 W7FNR9 W7JIE4
gi|225631998|emb|CAD52519.2| gi|296005468|ref|XP_001350110.2| XP_001350110.2.26446 PF13_0214 PFHG_02950T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]