SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF13_0272 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF13_0272
Domain Number 1 Region: 15-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.57e-33
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PF13_0272
Sequence length 208
Comment PF13_0272 thioredoxin-related protein, putative 19166558:19167530 reverse MW:23988
Sequence
MAIFKKSIIIFLFFTFFNYCFSQDVIELNDSNFESLTQLSTGNTTGSWFIKFYAPWCSHC
KAMSKTWAQLATELKGKINVAKIDVTLNSKTRKRFKIEGFPTLLYFKNGKMYDYKNHDRS
LEAFKNFVLETYKNAKASEPPKPLNYMDILKDFLNETFQNIDRIYKYAFPSLAVLVSVSF
LTGSIFSLILLKCCCMKSGASKVAKKKD
Download sequence
Identical sequences A0A024WL80 A0A024X3B0 A0A060RY51 A0A0L1IG45 A0A0L7KD91 Q8IDH5 W4ICC7 W7F8Q7 W7FP48 W7JNJ8
PF13_0272 XP_001350237.1.26446 XP_012764892.1.2076 5833.PF13_0272-1 PFHG_03051T0 gi|124513762|ref|XP_001350237.1| gi|23615654|emb|CAD52646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]