SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF14_0186 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF14_0186
Domain Number 1 Region: 201-284
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000261
Family Glutathione peroxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PF14_0186
Sequence length 671
Comment PF14_0186 conserved Plasmodium protein, unknown function 20770175:20772601 reverse MW:80240
Sequence
MMKKLILFVLFQVYIICIKNVKSVHHKKFFTINHVNVPIKVNTNQHRKLGYIDLKRKNND
ERKRNPFDAKLSNQKCPLRKVTFKGLMKATGISIPLLFGSLMLYNKIINDNSNLSAPEKV
MGRYLYKHNNKLLLSNVLDNERSHNIFYYIINNIFNNIRMFINFYLNIKKVKSKDILKEY
TILFFHSYNVDRFLQSRNIKTYSERLKEMYKQINKDNNVNVIYIPLDNKLMFNIKHFSNM
NNWYSVLFHDKEHILKLIKKYNIMNIPTMVLLDRNMNIINDNINYLLLYDNQGFPYKHIN
NFTYIKHVYDKNNNQYNLKNLNSDYIFFYFNNSKDNKQDIQTLLKIKKKLAQKNIKLDII
FIRDIERKITQNEKSEKNEKNENNMLDTTNQKDQEGISKNNNKLKVDEKDKNKLRINDNN
NNNNNNNNNNNNNNKHGVDNNDTMHNNQNNNMPMEDYLDDVYYLGNLENNVIYKLLLYDI
FDVTFKPISILVNKKGNLLNKYINVSKKENEITTFILSNHKSLNEKVNEKNYLFKYNNIS
SMNNLNAFSPIFILFSDKLDLDLLKQYNELIEEYNKNRKGKKINFYFLPNQEKKYDPLKK
LCSINNTTEIVILDLFNQKLYKENGNNINIIKKLENGKYIIDKEKFFNFLNKYYDDELYA
STIILTKESTS
Download sequence
Identical sequences Q8ILQ8 W7JM97
XP_001348359.2.26446 PF14_0186 gi|255528793|gb|AAN36798.2| gi|258597692|ref|XP_001348359.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]