SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF14_0545 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF14_0545
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-31
Family Thioltransferase 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PF14_0545
Sequence length 104
Comment PfTrx thioredoxin, putative 22316043:22316621 reverse MW:11716
Sequence
MVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEV
SEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA
Download sequence
Identical sequences A0A024UZ52 A0A024VL83 A0A024VYA8 A0A024WJ11 A0A024X0F8 A0A060S5G9 A0A0L1I397 A0A0L7K754 A0A0L7M3U4 A0A144A4E0 A0A2I0C2V5 Q7KQL8 Q9NFK9 W4I981 W4IXY3 W7F6V3 W7FXT4
XP_001348719.1.26446 XP_012765615.1.2076 PFHG_00690T0 gi|124809933|ref|XP_001348719.1| gi|23497618|gb|AAN37158.1| gi|75009811|sp|Q7KQL8.1|THIO_PLAF7 PFDG_03720T0 PF14_0545 5833.PF14_0545-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]