SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF14_0694 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF14_0694
Domain Number 1 Region: 411-525
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.28e-24
Family PDI-like 0.0014
Further Details:      
 
Domain Number 2 Region: 25-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000142
Family Thioltransferase 0.08
Further Details:      
 
Weak hits

Sequence:  PF14_0694
Domain Number - Region: 276-402
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0425
Family PDI-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PF14_0694
Sequence length 553
Comment PfPDI-14 protein disulfide isomerase 22935390:22937490 reverse MW:66518
Sequence
MHIDKLLIVFIFLIKLCVCHTEKGVKKEIVSINIDEFNNILKDEGNYTLLIVYTHWSYNS
NLLLENLDKLSKLLLYEENIKLCKINAAANTFIIDKLDVYSYPSLFMIRNKEIYRYNGVN
NIRGLLLWIYQYLDFKIYEINNIERLDVFIDLNEYNNTILFFIFKDLGTANNNINNISRI
NDLINICLLTNKTLCYYIKENNVIDYFEKNIIQDKYHYNLKNINQDSYYAILFKNDEFDD
YFFPLNKKELDMLSNNEYTNEEKIDHLYNWINEREQPLVIQFSEHFFSMLFSNDAVTLFI
IYNNINNINKDDIIKCAKKYNHKIKFAISGTTQIFEKRLLNELLIEDNIKKPLMRITEFK
NYIRFPYKYKPQSDDQEINEKTIDDFINGYLQEKKYFYRKSERALPDEYNNGYIKIIVAD
NYDQYVYKNDMNVIVLYYAPWCGHCYKFEPVYREVGKRLNLYAAKFKNYKNDIIISKIDA
VNNEIYNIHIEGYPTIYLYKKGDKLNPVRYMEGRTVKNIITWICKETQSNIDISEFLNID
LDNEQLFENYEEL
Download sequence
Identical sequences A0A0L1I863 A0A2I0C276 Q8IKB2 W4I706 W7FN68
PF14_0694 5833.PF14_0694-1 XP_001348868.1.26446 gi|124810388|ref|XP_001348868.1| gi|23497769|gb|AAN37307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]