SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFB0305c.2 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFB0305c.2
Domain Number 1 Region: 199-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFB0305c.2
Sequence length 261
Comment MSP5 merozoite surface protein 5 918832:919869 reverse MW:29533
Sequence
MNGHTHILNLNNKNENFLVVRRLMNDEKGEGGFTSKNKENGNNNRNNENELKEEGSLPTK
MNEKNSNSSDKQPNDISHDESKSNSNNSQNIQKEPEEKENSNPNLDSSENSSESATRSVD
ISEHNSNNPETKEENGEEPLDLEINENAEIGQEPPNRLHFDNVDDEVPHYSALRYNKVEK
NVTDEMLLYNMMSDQNRKSCAINNGGCSDDQICININNIGVKCICKDGYLLGTKCIILNS
YSCHPFFSILIYITLFLLLFV
Download sequence
Identical sequences A0A0L1I7G3 A0A2I0BV30 C6S3B2
gi|254688458|gb|ACT79305.1| gi|258537820|ref|XP_002585389.1| XP_002585389.1.26446 PFB0305c.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]