SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFC0640w from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFC0640w
Domain Number 1 Region: 67-274
Classification Level Classification E-value
Superfamily vWA-like 3.76e-34
Family Integrin A (or I) domain 0.0023
Further Details:      
 
Domain Number 2 Region: 564-757
Classification Level Classification E-value
Superfamily vWA-like 8.31e-34
Family Integrin A (or I) domain 0.0038
Further Details:      
 
Domain Number 3 Region: 300-493
Classification Level Classification E-value
Superfamily vWA-like 3.26e-32
Family Integrin A (or I) domain 0.0041
Further Details:      
 
Domain Number 4 Region: 844-1038
Classification Level Classification E-value
Superfamily vWA-like 3.56e-32
Family Integrin A (or I) domain 0.0021
Further Details:      
 
Domain Number 5 Region: 1298-1501
Classification Level Classification E-value
Superfamily vWA-like 1.29e-23
Family Integrin A (or I) domain 0.0035
Further Details:      
 
Domain Number 6 Region: 1078-1243
Classification Level Classification E-value
Superfamily vWA-like 9.2e-17
Family Integrin A (or I) domain 0.011
Further Details:      
 
Domain Number 7 Region: 1594-1645
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 8 Region: 1654-1703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 9 Region: 1800-1858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Weak hits

Sequence:  PFC0640w
Domain Number - Region: 1936-2001
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000235
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number - Region: 1505-1524
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0942
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFC0640w
Sequence length 2114
Comment CTRP CSP and TRAP-related protein 2203540:2209884 forward MW:237922
Sequence
MKKAFVLIFSCFLLFLPLHIVRTHYAKNEETNKKDTKLKKKRNVKTFNKKLTNKSFLQVQ
HTVATRSVPPPPCLGDDCFCQNYYDLTLILDESASIGSKNWKNHVIPFTDKIIKDLTISK
NEVHVGILLFSSKNRDYVTYGDELRYQKDELLKKVEKLKKDYYCGGGTKILGALKYSLEN
YTKHKNIRYDAPKVTILFTDGNENSASNKQLLEMGLTYRRERVKLLVLGVAAAEDNKLKL
IAGCEENTNCPYSMKAEWETINDITKRLTNKICHTESEIEPEPKPEPSTPTHCQGDDCFC
EDYYDLTLILDESRSITLDKWKKDVVPFAEKVLNNLNIDKDKIHVGIMRFAKSMKTDIGY
EQETRYMKNDLIKLVRELKDKYGYGGATHLVDALQYSLKTFTRHPNNRVDAPKVTILFTD
GNETSKKEKDIRDVGLLYRKENVKLIVVGVNLATEKSLKLLAGCTENEECLRVIKCEWND
LTNITKILTDKICNTGSVELPKPEENPEPVEKPNPEENPNPVEKPTPEENPNPVEKPTPE
ENPNPVEKPEPEKNPCINMEDCYCKDFYDITLVLDESASISDLIWRNEVIPFSLEIIKRI
NISYKNVHMGVLLFSEYTRDIVRFYDNARYEKGTLQTKINDLKRDYRSGKKTYIIQALQY
ALTYYSKLSNRKEAPKVTMLFTDGNDSYESEKGLQDIALLYRKENVKLLVVGVSTASENK
LKMLVGCAPNVVCPFVIKTEWGLLKNVSEVFVKKICDNGVVLPPGSPSESTPGSPSESTP
GSPSESTPGSPSESTPGNPSESTPGSPSESTPGNPSESTPGSPSESTPGSPSESTPCSGT
ECLCHNTYDLTLIIDESASIGYSNWEKEVVPFTIGLASNLEISEKKVNMGILLFSDKIRE
FIKYGQKESYDKNNLVRRIHDLKKYYKSGGFSYIVEALKYGLYSYAKSTSSRLNVPKVNI
LLTDGNNTDTSDFILTEVSSLYKKENVKLLLIGIGGPTIHKLRLLGGCDKSDGDCPYVVK
AEWNNLKYTSNLIIDKICHTDKPVENPGDNSSVCNSKDDCICANYFDLTYIEVPTLNSTY
TWRSDFMDCSKNIMNSLVIDKNKVHVSLIISLEKKSVHQGFDDVNSYNKNELIKTLGKLE
NSTVLNKTNILDSLVYGIQQSFGKGNRENAPKVTMLLTNSNSDISDEKALQDIYLNYKEK
SIKLLIIGIGITNTGKLFNAGGCNMNGDNCPHVYASKSFSYIGGVDTFLEVNKCDSSIDN
NGGDNGNGTEGNVNPDTPSCNDNDDDDKCNNDDSNIICTKVLDIAVVLDQSSNISKDQWN
VYIKQFVINTVNQNYLSKYRSHITIVKMGKSTKEKWSLNKKISYQKKKIIKEINKLPISY
SKKKDIAKSLKYVRTKVFKKSETNRKKLIIMLVEGKSNSNMNDLRKEVGLLKVNNIDFFA
YAIDNIDETEYKILGDCEGSVDMGLMGNSPPSPSYLPCKNIVKVSWDTLLSSTDIHMKYI
CNGYPEDAECSEWEEWSPCPETCPTINNNNNNSSGSNNSSRTNIRTYFPQLSKRERKGPY
TLKGEEYMGEKYGSSCMELKSIEYRSCPINAGCNDMCGDFGEWSECSATCGEGIRVRNRD
NSLDNDDKCKLFNSTEMEACNIQECDDNNNVDICEDIGEWSDWSSCSKTCGYSTRSRTFT
ILPEYIGEYPNCKIFERSETEVCAFIPACSDENCFEWEEWNEWSSPCSPRKRVQKARVLK
KDDVIISSGDNNNNNNNNAKRGMGHKNSTFTSYNNKKSDICEEEVRHYLDKVEYDEESTC
ENKNPCGDWSDWSECDRTCNVGVRIRHFISHMFDMVGDEDEKECLEYYNKVETQDCLHLP
PCDGGECSDWETWVECKEEDMIGNNCHKRNKKILTRKLELLKNKDITRTKNTSDVCNDYT
LFREEDCPQSNDTCINALCNEWEEWGDCSSTCGEGSFKIRKRKEPLELIPASQDINGNIG
LTCAQQNIKVEEREACIVPACEDESTNGGTEVEGSTPSSPSDSNNNDGSSGDNTGDSNDK
KGMGTGEKVSLAAGVIGLVALAAGGLIYGYNTLNGGEPPHSSNMEFENVENNSGTEEEEN
EDFEVVDADDPMWN
Download sequence
Identical sequences A0A2I0BTH5 O97267
XP_001351221.1.26446 5833.PFC0640w-1 gi|124504959|ref|XP_001351221.1| gi|4493942|emb|CAB38978.1| PFC0640w

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]