SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFC1050w from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFC1050w
Domain Number 1 Region: 161-207
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000105
Family Tudor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFC1050w
Sequence length 315
Comment PFC1050w survival of motor neuron (SMN)-like protein 2573329:2574674 forward MW:37461
Sequence
MDEFNETLEGLEEKIEEYEKQLALVRDEIKKYEKPEEENEQIKNLKKLEADMIEVINLTR
DLIKYKKQNELENDENKELERSGEVAPDIHEHIKESNKFIGRTCSLNYENKMVYGLIENV
VIHNNIEQLLIHIFETNDRIMIPPNYVQLNEVLNESALKENNQFQALYKKDGQWYDCIIS
KYKGDSFLITYIGYNNSEYVSTDQVRIKKKKKIKEIITPAGYKLPENLIIKEGDSLKVKM
AKKKKRIALKKKQKDEIMDKEFSNKSKQWRSFHEKAISKSKHLLVSTKRVENIENKNNQS
NFNIRRKFDYNDNEE
Download sequence
Identical sequences A0A024WDE3 A0A024WVX6 A0A024XDM6 O97304 W4IPU5 W7FTZ4 W7GCH0 W7K1G0
PFC1050w XP_001351306.1.26446 5833.PFC1050w-1 gi|124505129|ref|XP_001351306.1| gi|4493992|emb|CAB39051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]