SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFF0340c from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFF0340c
Domain Number 1 Region: 116-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-30
Family Thioltransferase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFF0340c
Sequence length 219
Comment PfGLP2 glutaredoxin-like protein, putative 5488567:5489226 reverse MW:26035
Sequence
MDFIKVEDQRKYIEGNKGYQLFYLNSSTSKEYGSHIDVLNMMLEDYSSVLKIYVINVVDD
NNKYEFQFYAKSQLIKSFVNTNIGSITSFLRKYMQTLSYEQDTEEKNKEKEREKQIIERI
QNLLKNNKIILFMKGTKTFPQCKFSNAVIFMLNSMKIKYETYNILEDQDIRAHLKIYSNW
PTYPQLYINTELIGGHDIIKSMYDNNELALIIPDDCFEE
Download sequence
Identical sequences C6KSR7 W7K9W4
XP_966059.1.26446 gi|46362301|emb|CAG25239.1| gi|86170662|ref|XP_966059.1| 5833.PFF0340c-1 PFF0340c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]