SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFI0790w from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFI0790w
Domain Number 1 Region: 66-173
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.11e-18
Family Thioltransferase 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFI0790w
Sequence length 179
Comment Trx3 thioredoxin reductase 3 10211728:10212817 forward MW:20812
Sequence
MALICIGSVCFSLFHIGVIILLIINYFSSHIKKIFPSFFKNPNKEIDKHIGNILEAKRKN
KQLEQSIYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYYYVTLV
DIDVDIHPKLNDQHNIKALPTFEFYFNLNNEWVLVHTVEGANQNDIEKAFQKYCLEKAK
Download sequence
Identical sequences XP_002808934.1.26446 PFI0790w gi|225631820|emb|CAX64215.1| gi|296005205|ref|XP_002808934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]