SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFI1680w from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFI1680w
Domain Number 1 Region: 420-522
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000388
Family UBX domain 0.018
Further Details:      
 
Domain Number 2 Region: 231-362
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000962
Family Thioltransferase 0.025
Further Details:      
 
Weak hits

Sequence:  PFI1680w
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily UBA-like 0.000148
Family TAP-C domain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFI1680w
Sequence length 531
Comment PFI1680w UBX domain, putative 10895069:10896920 forward MW:62570
Sequence
MNEFIKLFMDITKEDDEKKASSFLESYNWNVEEAITRYFIATKQKTSTEDVTTSNENNEN
NQVLEKKNKKKEKKNKKKEKKNKKKEKNKKEESNKKEEKNNIHINDAAIRNEYLHKNDED
NKDISDFSSISSDEGNIEEGNTLNNYEINEEEHVGRTNFLYFLNHIGKMVFPIFKNLYNV
MSSFFKILSTYIISSTTTSTAASASESPSTSTSTSTSPSSSEPYTSSYDNGFTKYYENKY
SKVHTDFFRGSLKEAINKSRREEKLLLVYLHIEYDDVSYFCEHVFNNLEMKSFFDENCIL
YAHDISKGDIKELSTTLNVFMLPQISIILTCYVTDMMELSIIYGQPSITHIMNTISHCIE
KMDMKREKMEMLKNKNYRDRLIREEQDREYQEALRKDRLKEEEKKKKENEKLVKIQEKNK
IKNERKEKTKKFPLCISSNEQIAKICIRLPNGIRIQNNFGLSNTLQDIYEWAECSEFLQP
QNQKVIIPYKFQLICSLTKWNVQRTSEQIKNFDLYPNAIFNMKSLDTSDEE
Download sequence
Identical sequences A0A2I0BSA0 Q8I2H1
gi|124507231|ref|XP_001352212.1| gi|23505242|emb|CAD52022.1| PFI1680w XP_001352212.1.26446 5833.PFI1680w-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]