SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFL2020c from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFL2020c
Domain Number 1 Region: 39-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000155
Family Thioltransferase 0.066
Further Details:      
 
Domain Number 2 Region: 365-444
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.00000889
Family FAD-dependent thiol oxidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFL2020c
Sequence length 531
Comment PFL2020c conserved Plasmodium protein, unknown function 16592608:16594203 reverse MW:63727
Sequence
MKVTYAVRLLLPVYFLFFWIHLNIVRSDNVCKGADVIVNEFWSKLNNIRHGDVILINIKN
YYCPACNRYMNIWNDVEKKILTYEKNVSLFVFDCSCYLLVPYCRYFDVLYFPTFRLLFPV
YDKINDKEYKYINPSSMIEGEKYNGDLLLAYREVERIDNIYDFKILIEKYLCKNVNFNYN
DLRICMNSSYILPEKKNKKKNEIYHFLFGYKNDKNKEEIKDSVNVMNDDFIENNYDYEEN
KENVERWSNHINFNKDNIKHDIIIGILFTLKKHISLGRDIQKEYIEPFLVMLSIVSNIYN
DLEEGLYDIINKLNSFTYPIKYDEWIKYTENINYINEYKLDYNNNNNNDTNLISFKLCEQ
NSVLCSYWLLYHKISVYCLQHDKHNYLYYIEAITNYTKNYLNCQNCIDHFLNAQKFCYYG
YCNIHSAESFIIFLWRIHNAVTLRSMYDLLMIDNNTSTPSNNFNKKQFLNQDIVFPTLKQ
CKNCRNALGFTKITNHTLSTFKNGSITDQSFDAIDSFSVKNVLHYLIHIYS
Download sequence
Identical sequences A0A0L7KAP4 Q8I509 W7F8B8 W7FEA4 W7KC14
PFHG_02138T0 5833.PFL2020c-1 gi|124806715|ref|XP_001350808.1| gi|23496937|gb|AAN36488.1| PFL2020c XP_001350808.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]