SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110347241|ref|YP_666058.1|NC_008243 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110347241|ref|YP_666058.1|NC_008243
Domain Number 1 Region: 4-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-65
Family ABC transporter ATPase domain-like 0.0000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110347241|ref|YP_666058.1|NC_008243
Sequence length 278
Comment ABC transporter related [Chelativorans sp. BNC1 plasmid 2]
Sequence
MSALLDVEDVRIDFTTRRGVVHAVRGVSFSIDQGESVAMVGASGSGKTVLGRSLLGLVEE
PGEVSGSIIFNGQQVVGSSESHLQPIRGLGMAMVFQDALDGLNPVYSIGSHLMEILTIRM
KKSRSEARHEALRLMEEVGIPNAKSRFHDYPHQFSGGMRQRICIALAIGLRPKILIADEP
TTALDVTVQAGILDLIRRLQDDYGMGLIFITHDLAVAQQISERVLVMYNGEIVEQGETRE
VFQHPKHRYTRALLASHPAHATSWRDLQPMPESFVLEA
Download sequence
Identical sequences Q11AV0
gi|110347241|ref|YP_666058.1| 266779.Meso_4447 gi|110347241|ref|YP_666058.1|NC_008243 WP_011578885.1.76240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]