SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116248757|ref|YP_764598.1|NC_008378 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116248757|ref|YP_764598.1|NC_008378
Domain Number 1 Region: 3-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.03e-78
Family ABC transporter ATPase domain-like 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116248757|ref|YP_764598.1|NC_008378
Sequence length 241
Comment ABC transporter ATP-binding protein [Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12]
Sequence
MSLIEITEVRKSFGTTEVLKGINLDVEAGEVIAIIGKSGSGKSTLLRCINGLETITDGSI
SVAGAQLLDDEVHLKALRLKVGMIFQQFNLFPHLTVGGNVMLSQTVVKKTPKAEAEATAR
KMLERVGLGHRFDAYPDELSGGQQQRVAIARALAMQPTALLCDEITSALDPELVAEVLAV
VRELAAEGMTLLMVTHEMKFARDVCNRVIFMHQGRVHEAGPPEEVFAKPQTAELKQFLGV
N
Download sequence
Identical sequences Q1M522
gi|116248757|ref|YP_764598.1|NC_008378 gi|116248757|ref|YP_764598.1| 216596.pRL120081 WP_011648876.1.53928 WP_011648876.1.54942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]