SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119714071|ref|YP_919213.1|NC_008697 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119714071|ref|YP_919213.1|NC_008697
Domain Number - Region: 4-54
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00261
Family MarR-like transcriptional regulators 0.095
Further Details:      
 
Domain Number - Region: 92-134
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0751
Family MRR-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119714071|ref|YP_919213.1|NC_008697
Sequence length 232
Comment hypothetical protein Noca_4764 [Nocardioides sp. JS614 plasmid pNOCA01]
Sequence
MATIAERILEAIQFGPLDDDVLAERLGVSPRQSINQAARRLEQQGCLRRFTGPDEKIVKA
LPEHPMPESPRPAEAPVRVQRLVFREDDVKAAVKAHLEERGFDVAVAWGKERGVDIDARH
LDGRRYMIEAKGGLASDQQQGSYFLGAIGELVQRMVDPEVQYGLALPLNRRYRGLVNRLP
RLAWERLGLVVFWVLRDLDGVMTVEVQEGPQGATETTGLEAKSPVEPDEEIY
Download sequence
Identical sequences A1SC15
WP_011751475.1.100580 WP_011751475.1.96005 196162.Noca_4764 gi|119714071|ref|YP_919213.1|NC_008697 gi|119714071|ref|YP_919213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]