SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119714205|ref|YP_919347.1|NC_008697 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119714205|ref|YP_919347.1|NC_008697
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily CheY-like 2.42e-35
Family CheY-related 0.00024
Further Details:      
 
Domain Number 2 Region: 142-213
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.07e-21
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119714205|ref|YP_919347.1|NC_008697
Sequence length 216
Comment response regulator receiver [Nocardioides sp. JS614 plasmid pNOCA01]
Sequence
MIRVLLADDQSLLRTGFRMILGAEPDVEVVGEARDGEEAVALVDELLPDVVLMDLRMPNM
DGIEATRRITAAHEAVRVVVLTTFDLDEYVYSSLRAGASAFLLKDAKEDQLVAAIRVAAD
GGSLFSPSVTKRLIGRFAAPASAPVAADLPALTNREREVWELVARGLSNAEITERLVISE
HTTKTHVASILQKLHVRGRVQAVVLAYESGLVQPGN
Download sequence
Identical sequences A1SCE9
196162.Noca_4902 gi|119714205|ref|YP_919347.1| WP_011751609.1.100580 WP_011751609.1.96005 gi|119714205|ref|YP_919347.1|NC_008697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]