SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124263097|ref|YP_001023567.1|NC_008826 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124263097|ref|YP_001023567.1|NC_008826
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-49
Family ABC transporter ATPase domain-like 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124263097|ref|YP_001023567.1|NC_008826
Sequence length 267
Comment ABC transporter ATP-binding protein [Methylibium petroleiphilum PM1 plasmid RPME01]
Sequence
MNDTVLAVNGIEVIYDRVILVLKGVSLQVREGGVAALLGGNGAGKTTALRAISNLLRGER
GEVTKGSIELRGERIDDLSPAQLVQRGVVQVMEGRHCFAHLTIEENLLAGAYTRKRSGEI
AANLDKVYTYFPRLKTRRASQAAYTSGGEQQMCAIGRALMANPSLVLLDEPSMGLAPQIV
EEVFEIVKDLNAKERVTFLLAEQNIQMALRYADHGYILENGRVVMNGPAPELAGNEDVKE
FYLGMGAGQRKSFRESKSYRRRKRWLA
Download sequence
Identical sequences A2SP43
WP_011831883.1.77188 420662.Mpe_B0564 gi|124263097|ref|YP_001023567.1|NC_008826 gi|124263097|ref|YP_001023567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]