SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134287693|ref|YP_001109859.1|NC_009227 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134287693|ref|YP_001109859.1|NC_009227
Domain Number 1 Region: 34-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.11e-17
Family Extended AAA-ATPase domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134287693|ref|YP_001109859.1|NC_009227
Sequence length 299
Comment TniB family protein [Burkholderia vietnamiensis G4 plasmid pBVIE02]
Sequence
MDEYPVIDLSHLLPAAQGLARLPADERIQRIRADRWIGYPRAVEALNRLETLYAWPNKQR
MPNLLLVGPTNNGKSMIVEKFRRAHPVGTDADQEHIPVLVVQMPSEPSVIRFYVALLAAM
GAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAGNSVNRREFLNLLRFLGNELR
IPLVGVGTREAYLAIRSDDQLENRFEPMLLPPWEANEDCCSLLASFAASLPLRRPSPIAT
LDMARYLLTRSEGTIGELAHLLVAAAVAAVESGEEAINHRTLSMADYMAPDQDSVELRS
Download sequence
Identical sequences A4JUX5
gi|134287693|ref|YP_001109859.1|NC_009227 gi|134287693|ref|YP_001109859.1| 269482.Bcep1808_7198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]