SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13488442|ref|NP_109449.1|NC_002682 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13488442|ref|NP_109449.1|NC_002682
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily CheY-like 4.41e-23
Family CheY-related 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13488442|ref|NP_109449.1|NC_002682
Sequence length 113
Comment response regulator [Mesorhizobium loti MAFF303099 plasmid pMLb]
Sequence
MLVVEDEPLIRMDIVDFLLGEGFEVLEAANADEAIDLLESNAQIQVMFTDIDMPGSMDGI
KLSAAVRDRWPPIRIVATSGHRAVSVADLPKGSLFYAKPYDNAAIAASIRDLV
Download sequence
Identical sequences Q98P67
gi|13488442|ref|NP_109449.1|NC_002682 266835.mll9592 gi|13488442|ref|NP_109449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]