SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148550714|ref|YP_001260153.1|NC_009507 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148550714|ref|YP_001260153.1|NC_009507
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.17e-22
Family Nitrogenase iron protein-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148550714|ref|YP_001260153.1|NC_009507
Sequence length 228
Comment stability/partitioning determinant [Sphingomonas wittichii RW1 plasmid pSWIT01]
Sequence
MPVITIAQSKGGAGKTTLALALASEFEALGGSVFMLDADRQNSLLNWYRDRMNADRAGEG
RITVEDASQLRDADIGPAIARARDAAQLVIVDSEGTSNFKTAYAAMDSDFVVIPTRSSRL
DLERTVETSDMLGKMCGGVPYRVLITQTGQVARSKAEWEIDSQISNALPTFNEQMHTLDA
FRAMSNYRMTLAEVEAAGLAKTEKARRIAQGILADILSEIQNKEAVNA
Download sequence
Identical sequences A5VGH0
392499.Swit_5278 gi|148550714|ref|YP_001260153.1|NC_009507 WP_011950540.1.69875 gi|148550714|ref|YP_001260153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]