SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16119399|ref|NP_396105.1|NC_003064 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16119399|ref|NP_396105.1|NC_003064
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily CheY-like 1.07e-29
Family CheY-related 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16119399|ref|NP_396105.1|NC_003064
Sequence length 224
Comment two component response regulator [Agrobacterium fabrum str. C58 plasmid At]
Sequence
MKLLLIEDDPEMTDALKVALSQHGIVLDAVGDLATAREAIIMADYDIVLIDRQLPDGDGS
TFLADLRRAGSNTRSIIISALRSTDERISGLNDGADDYLPKPFEIPELVARMSAVLRRAP
TTGPFVLSAGNVTYDRVSCDVHVNGIRLALTRRELLIIETLLRNRGRTVLRSSLEGQVYS
FDDEIQSNSLESNMSRLRRKLGEAEADIVIKNIRGIGYYLHEQK
Download sequence
Identical sequences A0A083ZMH1 A9CLL8
gi|16119399|ref|NP_396105.1| NP_396105.1.86381 WP_010974434.1.51814 WP_010974434.1.57042 WP_010974434.1.66048 WP_010974434.1.84136 176299.Atu5175 gi|16119399|ref|NP_396105.1|NC_003064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]