SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16120186|ref|NP_395774.1|NC_002608 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16120186|ref|NP_395774.1|NC_002608
Domain Number 1 Region: 17-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.95e-57
Family ABC transporter ATPase domain-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16120186|ref|NP_395774.1|NC_002608
Sequence length 258
Comment ABC transporter ATP-binding protein [Halobacterium sp. NRC-1 plasmid pNRC200]
Sequence
MEELRMTPHHDNTADTPAIELADVAFGYTATPVVEDISLAVSPGEYIGVVGPNGSGKSTL
MKLMLGLLRPDRGRARLFGVPAHQFDTGSRIGYVAQHASASKEMPITVREVVKMGRFPHV
GFGQLSADDWAVVDEALDTVGMSAFADRRVTELSGGQRQRAFIARALAGEAELLVFDEPT
VGVDIESVAAFYDLLDVLHDDGITVVLIEHDLGAVTEHAERVICLNRELHFDGPTAEFVD
SDALARAFGTTTAVLGDD
Download sequence
Identical sequences Q9HHR7
gi|16120186|ref|NP_395774.1|NC_002608 64091.VNG6264G WP_010904122.1.1784 WP_010904122.1.50382 gi|16120186|ref|NP_395774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]