SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16264442|ref|NP_437234.1|NC_003078 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16264442|ref|NP_437234.1|NC_003078
Domain Number 1 Region: 7-154
Classification Level Classification E-value
Superfamily CheY-like 7.03e-44
Family CheY-related 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16264442|ref|NP_437234.1|NC_003078
Sequence length 162
Comment response regulator protein [Sinorhizobium meliloti 1021 plasmid pSymB]
Sequence
MIHEVHGVARVIETLRPDVIVIDIENPNRDMMEHLFQLTRTVGRPIAMFVDRSDTASIEA
AVEAGVSAYIVDGLKKERVKPILDMAVSRFKAFSRLQRELAEAKSALEERKLVERAKGIL
MKMRGLSEDEAFALLRQTAMNEKKKISEIAQSVVTAAGLLIR
Download sequence
Identical sequences Q92VK7
gi|16264442|ref|NP_437234.1| gi|16264442|ref|NP_437234.1|NC_003078 266834.SM_b21115 NP_437234.1.96377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]