SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170076519|ref|YP_001733158.1|NC_010474 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170076519|ref|YP_001733158.1|NC_010474
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-29
Family Nitrogenase iron protein-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170076519|ref|YP_001733158.1|NC_010474
Sequence length 198
Comment ParA family partitioning protein [Synechococcus sp. PCC 7002 plasmid pAQ7]
Sequence
MQIITVTGYKGGVGKSTSAIHIAAYLARNQKTILIDGDPNRTALNWSQRGEMPFTVADER
QAMRLITGHDFVVIDTPARPNSDDLQELAKGCDLLILPTTPDVVSLEPMLAIANDVEDAR
YRALLTIVPPYPSKEGETMRNELIANGVPTFQSMIRRSAAFQKAALAGKPVNQMSGRDRI
PWNDFEALGKEMIEVLRQ
Download sequence
Identical sequences B1XRR9
gi|170076519|ref|YP_001733158.1| gi|170076519|ref|YP_001733158.1|NC_010474 WP_012305526.1.22074 WP_012305526.1.52632 WP_012305526.1.62705 32049.SYNPCC7002_G0049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]