SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170745197|ref|YP_001766654.1|NC_010510 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170745197|ref|YP_001766654.1|NC_010510
Domain Number 1 Region: 72-166
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.19e-16
Family ParB-like nuclease domain 0.0044
Further Details:      
 
Domain Number 2 Region: 158-235
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000000942
Family KorB DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170745197|ref|YP_001766654.1|NC_010510
Sequence length 336
Comment plasmid partitioning protein RepB [Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01]
Sequence
MSQKKRLSAIMGAPIQTDVASPAHPDSSTAYPPVTGVTPPPPVAEKRPAAARSIAAMWAA
ARPVAAQDGAVVELDPGLCEPSAIADRVPDATDATFEAFVDQIREEGQHTPILVRRHPTK
PDRYEIAYGRRRTRAATALGKPVRAVVQDLTDAELVIAQGSENLAREDLSYIERAHFARN
MERAGIARDLILKAMAVHRTELDRYLDIAESIPAPVLTIIGPAPKVGRPRWLTLADRIRA
ASPERIAAVLASPKLVGRPSDERFAVILTELAAPQPQKAKPKAETLKDPRGLKFARVERS
TTGLRLTLDETIAPGFGDYLADRLPELLAAYRASRG
Download sequence
Identical sequences A0A0N0B6P3 A0A154NPB2 B1M8M7
gi|170745197|ref|YP_001766654.1| WP_012329649.1.31760 WP_012329649.1.35747 426355.Mrad2831_5913 gi|170745197|ref|YP_001766654.1|NC_010510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]