SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17233118|ref|NP_490208.1|NC_003276 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17233118|ref|NP_490208.1|NC_003276
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.57e-26
Family Hypothetical protein TT1808 (TTHA1514) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17233118|ref|NP_490208.1|NC_003276
Sequence length 193
Comment hypothetical protein alr7102 [Nostoc sp. PCC 7120 plasmid pCC7120alpha]
Sequence
MTTAVRKFTLDEYLSYDDGTDTKYELVDGELVEMPPESDRNNLISLYLLSQFLKFIPIQL
IRHKDTELVVIGNRTRVRLPDLMILTQELFEAIAGRRATITPDMPSPAMVVEVVSPGKVN
EDRDYRYKRSEYAARGIPEYWIVDPEKSRITLLTLVDGLYEESVFQETDMIRSTTFPMLD
LTASQVLAAGLVL
Download sequence
Identical sequences A0A1Z4KV36 Q8YL33
gi|17233118|ref|NP_490208.1|NC_003276 103690.alr7102 gi|17233118|ref|NP_490208.1| WP_010999662.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]