SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186471022|ref|YP_001862340.1|NC_010625 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186471022|ref|YP_001862340.1|NC_010625
Domain Number - Region: 66-135
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000471
Family Rhamnogalacturonase B, RhgB, middle domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186471022|ref|YP_001862340.1|NC_010625
Sequence length 153
Comment hypothetical protein Bphy_6253 [Burkholderia phymatum STM815 plasmid pBPHY01]
Sequence
MSIFRASVFSTSLLVGAILCASVSAQPLPAPAMQNGIRYVTGGIGEDEVKAFHSVALKYN
VRITLSAKSGHYLSDVDVRISTGTRSLLVVRTAGPFLFAHLPAGQYQISARDRHVTETRK
VVVPARGGIDVHFSWEDPDRHDVMQLCTGCRTP
Download sequence
Identical sequences B2JWG7
391038.Bphy_6253 WP_012405453.1.55900 gi|186471022|ref|YP_001862340.1| gi|186471022|ref|YP_001862340.1|NC_010625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]