SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186471761|ref|YP_001863079.1|NC_010625 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186471761|ref|YP_001863079.1|NC_010625
Domain Number 1 Region: 8-175
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 3.32e-52
Family TnsA endonuclease, N-terminal domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186471761|ref|YP_001863079.1|NC_010625
Sequence length 282
Comment TnsA endonuclease [Burkholderia phymatum STM815 plasmid pBPHY01]
Sequence
MRARRFKTQHDIDRYVAQGYGQGVGADYKPWLRVQDVPSRGRSRKVHGLKTGRVHHVLSD
LEYAYLVALEFSERVTDIREQFPLLPLAPAQDFARQRGIRYPLYAQTTVPFVMTTDFVVT
VRADDGSVCEFARTVRYSDELASGRQLLRTLEKLELERTWWLHREVDWQIVTEQSVEPAT
ARNLIWLRGGAQIERALQSDDLRSQFAESLGEAGTHDRTLSALLRTVSYRLRLPYLDAVK
LFKYLVWHKVLLVDLKRPILLTSQAPEIRIAPASSAPVKRAA
Download sequence
Identical sequences B2JTY0
gi|186471761|ref|YP_001863079.1| WP_012406189.1.55900 gi|186471761|ref|YP_001863079.1|NC_010625 391038.Bphy_7027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]