SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221636289|ref|YP_002524165.1|NC_011961 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221636289|ref|YP_002524165.1|NC_011961
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily CheY-like 0.000000000000498
Family CheY-related 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221636289|ref|YP_002524165.1|NC_011961
Sequence length 168
Comment two component transcriptional regulator, winged helix family [Thermomicrobium roseum DSM 5159 plasmid unnamed]
Sequence
MEAGWRILVVDDERSFREGMARALESWAQVRGVDDLGEAQCLLSSWRPHAIIVDPVLRSG
DAIAFLSRVARTENVVVFCCVARRGYPFAFRDGRVRFLPREWSWRTLSSIIERSVRVLLE
KKQLVQMDERGACSGDDFPRDQDWSSQKREWPTPVSRAVVNYAEEAVQ
Download sequence
Identical sequences B9L519
WP_012643229.1.69661 309801.trd_A0883 gi|221636289|ref|YP_002524165.1|NC_011961 gi|221636289|ref|YP_002524165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]