SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|224985579|ref|YP_002642842.1|NC_012200 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|224985579|ref|YP_002642842.1|NC_012200
Domain Number - Region: 30-116
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00209
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|224985579|ref|YP_002642842.1|NC_012200
Sequence length 204
Comment hypothetical protein BSPA14S_D0022 [Borrelia spielmanii A14S plasmid A14S_lp17]
Sequence
MLFFSCKLPFNYIISHINYFISHINYFISHINYFISHINYFISHINYFISHINYFISYIN
YFISYINYFISYINYFISYINYFISYINYFISYINYFISYINYFISYINYFISYINYFIS
YINYFISYINYFISYINYFISYINYFISYINYFISYINYFISYINYFISYINYFISYINY
LNINQLVEIKLILINLISTSEALL
Download sequence
Identical sequences C0RC01
gi|224985579|ref|YP_002642842.1|NC_012200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]