SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307149831|ref|YP_003890874.1|NC_014502 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307149831|ref|YP_003890874.1|NC_014502
Domain Number - Region: 175-282
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00477
Family Very short patch repair (VSR) endonuclease 0.05
Further Details:      
 
Domain Number - Region: 45-106
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00628
Family LacY-like proton/sugar symporter 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307149831|ref|YP_003890874.1|NC_014502
Sequence length 334
Comment hypothetical protein Cyan7822_6862 [Cyanothece sp. PCC 7822 plasmid Cy782203]
Sequence
MHYPVVIIPSAIALYLESQKVRLPNYSKPKRQQPVVLPRFINSPWLWGVMGAILGLIIFI
LIKAQWSLISFILVMLGIAGVVVGLWILKKWMRQYYRQQEIDYTLKMEKWQKTQRLMQRY
HQRKSNVNPKVRAAQLRELLQGKVLQPTGKSLAQQGVSEKQFFEVLVSYFGNKVSFGGEF
PLDNSQFKYSHDIVYIDPTTGLHIDIEIDEPYEGKSKRPHHCIDDEKDKRRNDYFLKNNW
IIIRFAEEQIVRHPHQCCKCIAQTIADITANKSYLKAFDDIDELLPINCWTATDARRMAS
WKVREIYLEEMGVFKQMTYQSRNKNTKRWNKKKK
Download sequence
Identical sequences E0UNH9
WP_013325635.1.91546 gi|307149831|ref|YP_003890874.1| gi|307149831|ref|YP_003890874.1|NC_014502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]