SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312602242|ref|YP_004022087.1|NC_014718 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312602242|ref|YP_004022087.1|NC_014718
Domain Number 1 Region: 9-55
Classification Level Classification E-value
Superfamily CheY-like 0.00000000674
Family CheY-related 0.0024
Further Details:      
 
Domain Number 2 Region: 85-138
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000218
Family PhoB-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312602242|ref|YP_004022087.1|NC_014718
Sequence length 145
Comment transcriptional regulatory protein [Burkholderia rhizoxinica HKI 454 plasmid pBRH01]
Sequence
MPPHPQAVQRAVLILTARVDAHDQIAGLETGANDYRIKLLGPRLLIARARTLLRRMQPAP
TAVGAPPVGDALRSGEIVASPPNRKITWRGEMLKALRGIEFDGLDHSVNSSISRVRRRFE
TSSEPRKVKTIWRRGDLFSPSAWEE
Download sequence
Identical sequences E5ATZ4
gi|312602242|ref|YP_004022087.1|NC_014718 gi|312602242|ref|YP_004022087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]