SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317052852|ref|YP_004119618.1|NC_014842 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|317052852|ref|YP_004119618.1|NC_014842
Domain Number - Region: 145-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00103
Family Thioltransferase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317052852|ref|YP_004119618.1|NC_014842
Sequence length 207
Comment type-F conjugative transfer system pilin assembly protein TrbC [Pantoea sp. At-9b plasmid pPAT9B05]
Sequence
MKTFLMTALMLSAVFPCAARTAVQPVVSGDDMAYMKQQQRDLELFKSQLQGMNITLPAAQ
EGRVAQLQNDIAASQADQNSASRTTPAAIYFVSLGIPEEGLLPMLADARRFGIPATLRGL
LDNDFRKTASAMFELSKKDKQAGVQIDPTLYQQFGIKAVPALVVTCGGKFDVLYGSLPVK
QALEEVKQRGDCAGIAAQLLKNGEAAR
Download sequence
Identical sequences E6WNS7
gi|317052852|ref|YP_004119618.1| gi|317052852|ref|YP_004119618.1|NC_014842 WP_013512886.1.99583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]