SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317133948|ref|YP_004089859.1|NC_014824 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317133948|ref|YP_004089859.1|NC_014824
Domain Number 1 Region: 56-114
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000419
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317133948|ref|YP_004089859.1|NC_014824
Sequence length 119
Comment hypothetical protein Rumal_3531 [Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL01]
Sequence
MTVKDGTKTLVNGTDYTVSYLDNKNVGTAEIIVTGIGQYSGTTSLTFEIIAKVDSMLGDV
NGDGKINVTDITKVAVHIKGKKMLDDAVLQYADVNHDGKINVSDITKIAAHIKGKKLLF
Download sequence
Identical sequences E6UJX7
WP_013483522.1.49193 WP_013483522.1.63498 gi|317133948|ref|YP_004089859.1| gi|317133948|ref|YP_004089859.1|NC_014824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]