SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325965539|ref|YP_004243443.1|NC_015147 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325965539|ref|YP_004243443.1|NC_015147
Domain Number 1 Region: 6-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.11e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0011
Further Details:      
 
Domain Number 2 Region: 145-308
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.88e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0024
Further Details:      
 
Domain Number 3 Region: 313-391
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000000000000179
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325965539|ref|YP_004243443.1|NC_015147
Sequence length 410
Comment phthalate 3,4-dioxygenase, ferredoxin reductase subunit [Arthrobacter phenanthrenivorans Sphe3 plasmid pASPHE302]
Sequence
MDTVTVIVGSSIGGVRTAQSLRLEGYEGRIVIVGEETELPYDKPPLSKAVLAGTATEASA
CLLNRDQAQELGIELELGHAATGIDVAGNLLQLQGREALRFDNLVIATGAFARPSPWGHR
PGIHVLRTLDDARSLRADLAKGGQLAVIGAGFIGAEAAATARGLGLEVTVIDPLPVPMSR
IFNAEVGQWFGDLHRSNGVTTIFGTGVETIDGEQGSFTLRLTNGQNLEAATVLVGIGAVP
NDAWLSSSGLLVDNGLVLDEYCRTVDAPQIYGVGDVARWRHQKHGEDIRIEHWTNAVEQA
ACVAYNITHPENPRAYTPVEYVWSDQHDWKIQVVGRVGGNAEHVTIGHPEVHGRFAALYT
VDGTNLSGAAIVNWPKALLACRRGMGPGITVQELREKLEPMLDPQPLTAS
Download sequence
Identical sequences A0AWN4 F0MCQ3
gi|116662331|ref|YP_829385.1|NC_008538 gi|325965539|ref|YP_004243443.1|NC_015147 gi|116662331|ref|YP_829385.1| WP_011689787.1.14739 WP_011689787.1.37281 gi|325965539|ref|YP_004243443.1| 290399.Arth_4367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]