SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332308633|ref|YP_004436483.1|NC_015498 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332308633|ref|YP_004436483.1|NC_015498
Domain Number - Region: 56-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.016
Family Glutathione peroxidase-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332308633|ref|YP_004436483.1|NC_015498
Sequence length 101
Comment hypothetical protein Glaag_4292 [Glaciecola sp. 4H-3-7+YE-5 plasmid pGLAAG01]
Sequence
MTDISGLILLALAGGYVGTYAPLIKKLPRKTPSDRLKIAALSAVTGAMIAFMFMFKKESI
QHNIYDETYIYVWTFWCSACATSAPSLIASFSSKLKQHIAF
Download sequence
Identical sequences F4AU78
WP_013755085.1.56369 gi|332308633|ref|YP_004436483.1|NC_015498 gi|332308633|ref|YP_004436483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]