SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332308774|ref|YP_004436624.1|NC_015498 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332308774|ref|YP_004436624.1|NC_015498
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily CheY-like 2.13e-37
Family CheY-related 0.00014
Further Details:      
 
Domain Number 2 Region: 125-223
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.9e-26
Family PhoB-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332308774|ref|YP_004436624.1|NC_015498
Sequence length 228
Comment two component heavy metal response transcriptional regulator, winged helix family [Glaciecola sp. 4H-3-7+YE-5 plasmid pGLAAG01]
Sequence
MRLLIVEDETKTGDYLKQGLSEAGFQVSLARNGLDGHHFAMTESFEVIILDVMLPDVSGW
RILESLREANNDTPVLFLSARDSVDDRVKGLELGADDYLVKPFAFSEVLARVRTLIRRGG
AQKVEDTFKVADLEMSIPQRKVTRTGKRILLSNKEFSLLELLLRREGEVLPRSLIASQVW
DMNFDSDTNVIDVAIRRLRGKVDDEFGLKLIHTVRGMGYKLEVETDES
Download sequence
Identical sequences F4AUL9
WP_013755226.1.56369 gi|332308774|ref|YP_004436624.1| gi|332308774|ref|YP_004436624.1|NC_015498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]