SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345301738|ref|YP_004821686.1|NC_015963 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345301738|ref|YP_004821686.1|NC_015963
Domain Number 1 Region: 83-158
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.00000000068
Family ParB-like nuclease domain 0.011
Further Details:      
 
Domain Number 2 Region: 160-247
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000144
Family KorB DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345301738|ref|YP_004821686.1|NC_015963
Sequence length 326
Comment parB-like partition protein [Enterobacter asburiae LF7a plasmid pENTAS01]
Sequence
MKRAPVIPKHSVKNAPAEIEQPASVAPAAPMVDSLIARVGAMARGNSILLPVCGREVKFT
LEAIPGDTAETASRVWSGNERDQELLTEDALDDLIPSFLLSGQQTPAFGRRVSGVIEVAD
GSRRRKAAILTSSDYRILVGDLDDEQMMALSRLGNDYRPTSAYERGKRYAYRLENEFGGN
VSALADAENISRKIITRCINTARLPKPVVALFIHPGELSARAGEALYKAFTGKEDLLQQL
TAQLHEQKKAGVIFEGDEVIGLLTGKLKESSSAKVNLSTRHQFVPGASVLYKGDKVIFNL
DKTRLPAECIEKIEGILRELQQNKSL
Download sequence
Identical sequences A0A198GEK3 G2SDF5
gi|345301738|ref|YP_004821686.1| WP_014063950.1.75813 WP_014063950.1.95910 WP_014063950.1.96315 gi|345301738|ref|YP_004821686.1|NC_015963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]