SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374294202|ref|YP_005041227.1|NC_016624 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294202|ref|YP_005041227.1|NC_016624
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily CheY-like 1.57e-19
Family CheY-related 0.003
Further Details:      
 
Domain Number 2 Region: 151-217
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.76e-19
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374294202|ref|YP_005041227.1|NC_016624
Sequence length 222
Comment Two-component response regulator, LuxR/FixJ family [Azospirillum lipoferum 4B plasmid AZO_p5]
Sequence
MQVLIADDHSIVRSGLTHLVGELDEQATVVAATSFSQLNAILDSSMLEGGSAFDLIVMDL
RMPGLGGLDDVEALVKRVAPVPVAVFSMIESPDEMRAVLSRGVRAFIPKSTDDVLVVNIL
RLVMAGGSYVPPVLGMPGAPVAAGAAPARGGAPSVFDGLTRRQLEVLDLLAQGLSNQEIG
ERLGLNLSTVKTHVTGVLKALGVGSRTQAVLLVKESGRDRLV
Download sequence
Identical sequences G7ZI54
WP_014249981.1.44154 gi|374294202|ref|YP_005041227.1| gi|374294202|ref|YP_005041227.1|NC_016624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]