SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|377807196|ref|YP_004980143.1|NC_016591 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377807196|ref|YP_004980143.1|NC_016591
Domain Number 1 Region: 38-125
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.0000314
Family ParB-like nuclease domain 0.036
Further Details:      
 
Domain Number 2 Region: 150-227
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000772
Family KorB DNA-binding domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|377807196|ref|YP_004980143.1|NC_016591
Sequence length 320
Comment hypothetical protein BYI23_E001950 [Burkholderia sp. YI23 plasmid byi_2p]
Sequence
MEQNANEAAPQNLELQFMDPVVKGNLKSAMKVAGASSADLWSIPPDCIETISHYNIREVD
AEYEAKVESLTRSMLDPNVGFKRDTPLSVIVVREDGKDVIRLKSGHRRLEAAKRAIARGA
TFKVVYAVVSTNTSEEEMLADLHRDNDSDKLQPYELAKLAKLMSVYIEKPSDIAKKLVLD
PGYVQDLLMLIDGPFVIREYVRKRTITATFAIDTMKQYGNKAVDIVEQALLRARAKGSKT
VSAKHVPGALVKKAVTRAAPQMRTAITSVKTDPAYAQLAPETRTTIDAIFDALKAAENEE
HQLAEKVASADSSGQESLAA
Download sequence
Identical sequences G8MPU1
gi|377807196|ref|YP_004980143.1| gi|377807196|ref|YP_004980143.1|NC_016591 WP_014194314.1.56761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]