SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384539248|ref|YP_005723332.1|NC_017326 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384539248|ref|YP_005723332.1|NC_017326
Domain Number 1 Region: 185-248
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000578
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0037
Further Details:      
 
Domain Number 2 Region: 41-163
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000256
Family CheY-related 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384539248|ref|YP_005723332.1|NC_017326
Sequence length 258
Comment LuxR family two component transcriptional regulator [Sinorhizobium meliloti SM11 plasmid pSmeSM11d]
Sequence
MASFTPKLENELPFAQDQHRVTNPLQSGKEAEQQPLAKKDKRCLLIFDDRALGRECLART
LVDHGLRMEVAAFGSFDEWQETKGSYPDVGAVLLNIGARKVGDVTADISKLASQFNPAPV
VVLSDSDDIAQILQVLESGAQGYIPASVGVDVCIEAIALAMAGGVFVPGSSLLAARHLIE
AEKRETSPLAGMFTLRQAEVVEALRRGKANKIIGYELNLRESTVKVHVRNIMKKMKATNR
TEVACKLNELFSGDARGS
Download sequence
Identical sequences F7XH05
gi|384539248|ref|YP_005723332.1| gi|384539248|ref|YP_005723332.1|NC_017326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]