SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389874761|ref|YP_006374117.1|NC_017958 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389874761|ref|YP_006374117.1|NC_017958
Domain Number 1 Region: 71-201
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.78e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389874761|ref|YP_006374117.1|NC_017958
Sequence length 203
Comment hypothetical protein TMO_c0525 [Tistrella mobilis KA081020-065 plasmid pTM3]
Sequence
MTLKIYGMSASRTSRNLWMAEELGIAYEHIPVKIADAASDPDIARLNPNLRIPVIEDDGV
VITESMAINLYLAAKHGGPLAAGNAAEAGLMAQWSFWAVTDLEALSLTVLLHRLVLRGEA
RDAARAEAAEASLARPLAVLDKALARGDGWLVGGRFTVADLNVSAIVHWLAAARMDLSGV
PNVADWVKRCRDRDAAKTAQKLP
Download sequence
Identical sequences A0A2D8Q871 I3TWJ7
WP_014748124.1.78709 gi|389874761|ref|YP_006374117.1| gi|389874761|ref|YP_006374117.1|NC_017958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]