SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389874808|ref|YP_006374164.1|NC_017958 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389874808|ref|YP_006374164.1|NC_017958
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily CheY-like 9.82e-28
Family CheY-related 0.0052
Further Details:      
 
Domain Number 2 Region: 138-206
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 8.5e-17
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389874808|ref|YP_006374164.1|NC_017958
Sequence length 217
Comment two-component response regulator [Tistrella mobilis KA081020-065 plasmid pTM3]
Sequence
MSYRILIADDHPLMRAALCQAVADSLPGSETMQASDFSTVETALAHDDAVDCVLLDLHMP
GMNGLIGLMLLRNEHPAIPVIVVSAMEDAATIRRAMQYGASGFVPKSAPVDRLGAAIRAV
IEGQIWQPDTDEADTAEDVDVADRIAGLTPQQLRVLAGIAEGKLNKQIAYEMGVVETTVK
AHVTVILRRLGVVSRTQAAILAGRLALHATEVETAGS
Download sequence
Identical sequences I3TWP4
gi|389874808|ref|YP_006374164.1|NC_017958 gi|389874808|ref|YP_006374164.1| WP_014748171.1.78709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]