SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392377202|ref|YP_004984361.1|NC_016594 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392377202|ref|YP_004984361.1|NC_016594
Domain Number 1 Region: 10-129
Classification Level Classification E-value
Superfamily CheY-like 1.85e-35
Family CheY-related 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392377202|ref|YP_004984361.1|NC_016594
Sequence length 135
Comment cell division response regulator DivK [Azospirillum brasilense Sp245 plasmid AZOBR_p1]
Sequence
MSVQTLTATRRTILVVDDNALMRKLLVRCLEEGGHRVVETDDPRGVLDLMRALKPDLVIM
DVVMPGLSGVELVRLIRADRALARTLVVAVTNLSTPTDMLRFSKAGFDGHVPKPIQPKDF
LATITRYLDGKGDRI
Download sequence
Identical sequences G8AQ60
WP_014197081.1.1190 gi|392377202|ref|YP_004984361.1| gi|392377202|ref|YP_004984361.1|NC_016594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]