SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392378076|ref|YP_004985235.1|NC_016594 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392378076|ref|YP_004985235.1|NC_016594
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily CheY-like 6.26e-16
Family CheY-related 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392378076|ref|YP_004985235.1|NC_016594
Sequence length 104
Comment two-component response regulator (fragment), partial [Azospirillum brasilense Sp245 plasmid AZOBR_p1]
Sequence
MAALEDGGLDCVILDLVMPGTSGTQLCERFDRFRRRRGLFFQIVILTSQEGDDRLTASLT
AGADDFVGKSQPMDILKIRLMALLRRKYMVEDHLARLSPPMPSA
Download sequence
Identical sequences G8ASR2
gi|392378076|ref|YP_004985235.1|NC_016594 gi|392378076|ref|YP_004985235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]