SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407690706|ref|YP_006814290.1|NC_018683 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407690706|ref|YP_006814290.1|NC_018683
Domain Number 1 Region: 46-112
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.14e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0029
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily CheY-like 0.00000205
Family CheY-related 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407690706|ref|YP_006814290.1|NC_018683
Sequence length 116
Comment transcriptional regulatory protein fixJ [Sinorhizobium meliloti Rm41 plasmid pSYMA]
Sequence
MAVGAKKAGAVDFIEKPFEDTVIIEAIERASERLVVPEADADEANGIRARLQTLSERERQ
VLSAVVASLPNKSIAYDLDISPRTVEVHRANVMTKMKAKSLPHLVRMALAGGFGPS
Download sequence
Identical sequences WP_014989942.1.3038 WP_014989942.1.55094 WP_014989942.1.96031 gi|407690706|ref|YP_006814290.1| gi|407690706|ref|YP_006814290.1|NC_018683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]